AdvisorCensus by AdvisorSEO Max

AdvisorCensus / Financial advisors in the United States / Colorado / Denver, CO / Financial advisors for business owners in Denver, CO

Financial advisors for business owners in Denver, CO

AdvisorCensus lists 2 investment advisory firms with a principal office in the Denver metro area that state a focus on business owners in their own words: in the firm's Form ADV Part 2A brochure or on its own website, each sentence checked word for word, or on its AdvisorCensus profile, which the firm attests. Filings as of October 2026. Each firm shows where its statement comes from; firms are listed alphabetically, and the controls below sort by years registered or assets band.

Source: Form ADV filings as of October 2026 · Rebuilt monthly · How this list is built

2
investment advisory firms
1
fee-only firms
2
SEC-registered
0
state-registered
246,723
households earning $200k+
1 of 2 firms matchesShowing 1 to 1
Greenwood Village, COSEC-registered investment adviserfinanciallyspeakinginc.comStated in its Form ADV brochure
Individuals% of assetsFixed fee
Registered35 years
Assets managed$100 million to $500 million

Market overview

Denver has 697 investment advisory firms with a principal office in the metro area as of October 2026: 269 SEC-registered, 158 state-registered, and 270 exempt reporting advisers. 160 of them meet AdvisorCensus's fee-only test (paid only by client fees, with no sales-related compensation ties such as an employee registered with a broker-dealer or licensed as an insurance agent), and 152 report under $100 million in regulatory assets under management. The metro area has 1,221,636 households, 246,723 of them with income of $200,000 or more, or 354 such households for each firm (Census Bureau, American Community Survey 2020–2024 5-year estimates).

RegistrationFirms
SEC-registered investment advisers2
State-registered investment advisers0
Exempt reporting advisers0
Compensation arrangements (Item 5.E)Firms
Fee-only (AdvisorCensus test)1 (50%)
Percentage of assets2 (100%)
Hourly charges1 (50%)
Subscription fees (newsletter or periodical)0 (0%)
Fixed fees2 (100%)
Commissions0 (0%)
Performance-based fees0 (0%)
Other0 (0%)
No compensation arrangements reported (exempt reporting advisers don't file Item 5.E)0
Years registeredFirms
Under 5 years1 (50%)
5 to 9 years0 (0%)
10 to 19 years0 (0%)
20 years or more1 (50%)
Not reported0 (0%)
Regulatory assets under managementFirms
Under $25 million0 (0%)
$25 million to $100 million0 (0%)
$100 million to $500 million2 (100%)
$500 million to $1 billion0 (0%)
$1 billion to $5 billion0 (0%)
Over $5 billion0 (0%)
Not reported0 (0%)

How to compare these firms

How the firm is paid

Form ADV Item 5.E lists every way a firm is paid for advice, and the "How paid" filter above lists each one. Of the 2 firms on this page, 2 charge a percentage of assets, 1 charges hourly, 2 charge fixed fees, and 0 list commissions. Commissions and other sales pay more often reach a firm through its people's broker-dealer registrations or insurance licenses, or through a related company, which Item 5.E doesn't cover; the 1 firm that meets AdvisorCensus's fee-only test has none of these ties. Read the guide on fee-only, fee-based, and commission arrangements.

Fee-only, fee-based, and commissions

Who regulates the firm

2 firms here are registered with the SEC, which generally means at least $100 million in regulatory assets under management; 0 are registered with a state securities regulator, typical of smaller firms; 0 are exempt reporting advisers (private fund and venture advisers that file a shorter form and generally do not serve individual clients). The registration type says who examines the firm, not how good it is.

SEC and state registration

Disclosures

Every firm page shows how many of the Form ADV Item 11 disciplinary questions the firm answered yes, with a link to the full record on the SEC's Investment Adviser Public Disclosure site. A yes can range from a decades-old matter at an affiliate to a recent regulatory action; read the record before drawing a conclusion.

Reading a firm's disclosures

Size and tenure

Regulatory assets under management and years registered describe scale and track length, not quality. A small firm may be a single planner who works with a few dozen households; a large one may be an institutional manager that does not take individual clients at all. The client types on each firm page (individuals, high-net-worth individuals, pension plans, and so on) say whom the firm actually serves.

What assets under management means

Questions people ask

How many financial advisory firms are there in Denver, CO?

AdvisorCensus lists 697 investment advisory firms with a principal office in the Denver metro area, from Form ADV filings as of October 2026: 269 SEC-registered, 158 state-registered, and 270 exempt reporting advisers. Firms may request removal, so the count can differ slightly from the number of firms that file Form ADV.

How does AdvisorCensus know a firm works with business owners?

The firm says so in its own words, in one of three places, and each firm on the page shows which: its current Form ADV Part 2A brochure, where AdvisorCensus checks the sentence word for word; its own website, at a domain it filed on Form ADV, where the firm says it specializes in or works with the group in a sentence found word for word on the page; or its AdvisorCensus profile, which the firm attests. Presence on this page means the firm states the focus; it does not mean the firm works only with that group, and absence means no such statement was found.

How many fee-only financial advisors are in Denver, CO?

160 of the 697 firms meet AdvisorCensus's fee-only test: paid only by a percentage of assets, hourly charges, fixed fees, or subscription fees on Form ADV Item 5.E (no commissions, performance-based fees, or other compensation), with no sales-related compensation ties in the same filing: no employee registered with a broker-dealer or licensed as an insurance agent (Item 5.B), no brokerage, insurance, real estate, or other product sales business (Item 6.A), no related broker-dealer, insurance company, real estate broker, or futures commission merchant (Item 7.A), and no referral fees from others or other sales interest (Item 8). Form ADV has no fee-only box, so this is derived from the filing; it is not a fee-only certification, and a firm's own page lists its compensation arrangements as filed.

How many financial advisors in Denver, CO offer financial planning?

284 of the 427 firms in Denver, CO that answer Form ADV Item 5.G, which asks what advisory services a firm provides, report financial planning services, as of October 2026. Exempt reporting advisers do not answer Item 5.G. Each firm page lists every advisory service the firm reports.

Are the financial advisors in Denver, CO fiduciaries?

Every firm on this page is an investment adviser that files Form ADV, and an investment adviser owes its clients a fiduciary duty under federal law, made up of a duty of care and a duty of loyalty: it must act in the client's best interest and not put its own interests ahead of the client's, and must eliminate its conflicts of interest or disclose them fully and fairly. Form ADV has no fiduciary box because the duty comes with being an investment adviser. The duty covers the firm's advice; a firm or its people may also sell securities through a broker-dealer or insurance as licensed agents, roles held to other standards. The 160 firms that meet AdvisorCensus's fee-only test report none of those sales ties.

How do I check whether a financial advisor has disciplinary disclosures?

Each firm page shows how many Form ADV Item 11 disciplinary questions the firm answered yes and links to the firm's record on the SEC's Investment Adviser Public Disclosure site (adviserinfo.sec.gov), where the detail of each disclosure is public. Individual advisers' records are on the same site and on FINRA BrokerCheck.

Does AdvisorCensus rate, verify, or recommend these firms?

No. The directory shows what each firm filed, in alphabetical order unless you choose another sort, and no firm's position depends on payment. Firms that claim their page can add a description and links, marked as provided by the firm; the filed facts are never changed by that content.

What does regulatory assets under management mean?

Regulatory assets under management (RAUM) is the figure a firm reports on Form ADV Item 5.F: the securities portfolios it provides continuous and regular supervisory or management services for, at market value, including assets managed without discretion. It measures scale, not performance or quality.

Related pages

Methodology

What Form ADV is

Form ADV is the registration form investment advisers file with the SEC or with state securities regulators, and update at least once a year. Part 1 reports the firm's identity, registration, ownership, clients, assets under management, compensation arrangements, advisory activities, and disciplinary disclosures. AdvisorCensus reads the SEC's monthly roster, the IAPD compilation feeds for state-registered advisers, and the SEC's filing data, and presents the answers as filed with the period they come from.

How firms are assigned to a metro area

A firm's principal office ZIP code is matched to a core-based statistical area with the HUD-USPS crosswalk, taking the area that holds most of the ZIP's business addresses. A ZIP the crosswalk doesn't carry, such as a PO box, is placed by the filed city and state when every ZIP of that city with the same first three digits falls in one area. Firms whose filing suppresses the office address (a private residence) are placed from the mailing address when one is filed. A state-registered firm that publishes no address appears on the page of the one state it is registered in, because a state-registered adviser registers with the state of its principal office; other firms that publish no address appear on the national index only. Firms in micropolitan areas and outside any statistical area appear on their state page. Metro pages cover the 387 metropolitan statistical areas in the 50 states and the District of Columbia (OMB Bulletin 23-01); Puerto Rico's six are not included.

How the niche pages are derived

A firm appears on a niche page when it states a focus on that client group in its own words, in one of three places. In its current Form ADV Part 2A brochure: the sentence must appear word for word in the brochure, name the group, and state a specialization ("we specialize in", "we work primarily with") that nothing negates. On its own website, at a domain it filed on Form ADV: a sentence in which the firm itself says it specializes in, focuses on, or works with that group, naming the group right after, found word for word on the page it was read from; only the latest reading of the site counts. Or on its AdvisorCensus profile, which the firm attests; those firms are marked "Provided by the firm". Each firm on the page shows where its statement comes from. Presence means the firm states the focus; it does not mean the firm works only with that group, and absence means no such statement was found.

What AdvisorCensus does not do

AdvisorCensus does not verify, rate, review, rank, or recommend firms. Every figure is a filed figure with its period and a link to the firm's record on the SEC's Investment Adviser Public Disclosure site. Order on this page is alphabetical unless you choose another sort, and it never depends on whether a firm has claimed or paid for its page.

Metro area: Denver-Aurora-Centennial, CO (core-based statistical area 19740).

Cite this page

AdvisorCensus. Financial advisors for business owners in Denver, CO: 2 firms from Form ADV filings as of October 2026.
https://advisorcensus.com/advisors/co/denver/business-owners